PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G207200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 27424.6 Da    PI: 7.0595
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G207200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.6e-26959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien++ rqvtfskRr g+lKKA+EL +LCda++ v+ifs +gk+yeyss
  Brast09G207200.2.p  9 KKIENTTSRQVTFSKRRMGLLKKANELAILCDAQIGVVIFSGSGKMYEYSS 59
                        68***********************************************96 PP

2K-box578.6e-20851621491
               K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         +++  +e++++k+e++ L+   R+++GedL+sL+l++  +Leqq+e sl kiR +K++ll +q+ e+++ e  + e++
  Brast09G207200.2.p  85 QQKIIHEMTRMKDETNRLKIIMRQYMGEDLGSLTLQDVLNLEQQIEFSLYKIRLRKQQLLDQQLLEMRHGEMHIPEDQ 162
                         578889***************************************************************998877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.034161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-38160IPR002100Transcription factor, MADS-box
CDDcd002651.16E-37276No hitNo description
SuperFamilySSF554552.49E-29278IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1782162IPR002487Transcription factor, K-box
PROSITE profilePS5129712.54985183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRGKVELKK IENTTSRQVT FSKRRMGLLK KANELAILCD AQIGVVIFSG SGKMYEYSSP  60
PWRITTIFDR YLKAPSTRFD EMDIQQKIIH EMTRMKDETN RLKIIMRQYM GEDLGSLTLQ  120
DVLNLEQQIE FSLYKIRLRK QQLLDQQLLE MRHGEMHIPE DQSSYLCHMD PASGQQSQAA  180
EMMDPKLFPL WDVGSQLYSQ DAESSMTALK LSQEYKLQPL QPNLQEADLH GYVLRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-15260159Myocyte-specific enhancer factor 2A
3p57_I1e-15260159Myocyte-specific enhancer factor 2A
3p57_D1e-15260159Myocyte-specific enhancer factor 2A
3p57_C1e-15260159Myocyte-specific enhancer factor 2A
3p57_B1e-15260159Myocyte-specific enhancer factor 2A
3p57_A1e-15260159Myocyte-specific enhancer factor 2A
3kov_J1e-15260159Myocyte-specific enhancer factor 2A
3kov_I1e-15260159Myocyte-specific enhancer factor 2A
3kov_B1e-15260159Myocyte-specific enhancer factor 2A
3kov_A1e-15260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693320.0KF469332.1 Brachypodium distachyon MADS-box transcription factor 38 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758884.11e-168PREDICTED: MADS-box transcription factor 31-like isoform X3
SwissprotQ84NC26e-90MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A0Q3GU391e-164A0A0Q3GU39_BRADI; Uncharacterized protein
STRINGBRADI5G21700.11e-163(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.31e-42MIKC_MADS family protein